PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03176.1.p
Common NameEUGRSUZ_F03176, LOC104450012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 306aa    MW: 33862.9 Da    PI: 5.0069
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03176.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-151461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+ Ed++l d++k  G g W+  +++ g++R++k+c++rw++yl
  Eucgr.F03176.1.p 14 RGAWTAMEDKILTDYIKANGDGKWRNLPKKAGLRRCGKSCRLRWLNYL 61
                      89********************************************97 PP

2Myb_DNA-binding513.3e-1667110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ T +E+el+++++++lG++ W++Ia +++ gRt++++k++w++
  Eucgr.F03176.1.p  67 RGNITLDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                       7899******************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.576961IPR017930Myb domain
SuperFamilySSF466894.3E-2712108IPR009057Homeodomain-like
SMARTSM007171.6E-111363IPR001005SANT/Myb domain
PfamPF002496.6E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-211568IPR009057Homeodomain-like
CDDcd001677.75E-91661No hitNo description
PROSITE profilePS5129424.43462116IPR017930Myb domain
SMARTSM007176.6E-1566114IPR001005SANT/Myb domain
PfamPF002493.3E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-2469116IPR009057Homeodomain-like
CDDcd001671.76E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRSPCCAKE GMNRGAWTAM EDKILTDYIK ANGDGKWRNL PKKAGLRRCG KSCRLRWLNY  60
LRPDIKRGNI TLDEEELIIR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT TIGRKLQSSS  120
SNSGFVSSRP SLSSFQGSPK SALEKLTIDD TLMPVEPRVS HAKAPACPKA LLSPASCQDR  180
EAQAPDMVDD KDQSSDRHED QVTTVRASDG NSNVSCNFMA DFELDANFLE AFLESELATD  240
TQQSCFVNSG LDDSHKRELP PLKSSRDSQE TLAFIDPGET ILSEPDLQCM ASLLEDEIDG  300
FNTTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03176.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062698.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLA0A059BU760.0A0A059BU76_EUCGR; Uncharacterized protein
STRINGVIT_09s0002g01400.t018e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-63myb domain protein 3